PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4BL_7DA93696E.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YA
Protein Properties Length: 362aa    MW: 39452 Da    PI: 7.4591
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4BL_7DA93696E.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA106.52.1e-33253309158
              CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                            +ep+YVNaKQy++Il+RRq Rakle+e+kl  ksrkpylheSRh+hA++R+Rg+gGrF
  Traes_4BL_7DA93696E.1 253 EEPIYVNAKQYHAILRRRQLRAKLEAENKL-VKSRKPYLHESRHQHAMKRARGTGGRF 309
                            69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.5E-38251312IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115239.328252312IPR001289Nuclear transcription factor Y subunit A
PfamPF020457.6E-29254309IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.1E-24255277IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860257277IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.1E-24286309IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
FRTLLLRSCG LCCEIFLHLV FCLTVLSSGL WVILFSGLVG EWTVGGGDKA NREILQPSQS  60
QSQAERETET EGEKTCRGEE QVAEEAAARE EGSPEGGHAP STSHISQLEL RARVETHKMR  120
RKQNMHENGT IMIQFGQQVP NCESSASDSP QEVSGMSEGS FNEQNDQSGN RDGYTKSDEG  180
KMMSALSLGN SETAYTPPKP DRTHPFAISY PYADPYYGGA VAAYGTHAIM HPQMVGMVPS  240
SRVPLPIEPA AAEEPIYVNA KQYHAILRRR QLRAKLEAEN KLVKSRKPYL HESRHQHAMK  300
RARGTGGRFL NAKEKSEAAS GGGNASARSG HAGVPTDGGG MFSKHDHTLP SGDFHYRARG  360
GA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A7e-24253316265NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1117122KMRRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5682980.0AY568298.1 Triticum aestivum CCAAT-box transcription factor complex WHAP4 (WHAP4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014754217.11e-150PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
TrEMBLW5E4V00.0W5E4V0_WHEAT; Uncharacterized protein
STRINGMLOC_62730.11e-176(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.13e-35nuclear factor Y, subunit A3
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]